PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004513659.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 197aa    MW: 23227.5 Da    PI: 9.7307
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004513659.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.45.1e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    +rienk+nrqvtfskRr g+lKKA+EL+vLCdaeva+iifss+gkl+ yss
  XP_004513659.1  9 ERIENKINRQVTFSKRRSGLLKKAFELCVLCDAEVALIIFSSRGKLFQYSS 59
                    69***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.8E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.964161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.97E-32278IPR002100Transcription factor, MADS-box
CDDcd002656.58E-39278No hitNo description
PRINTSPR004041.4E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-293859IPR002100Transcription factor, MADS-box
PfamPF014862.6E-2185170IPR002487Transcription factor, K-box
PROSITE profilePS5129714.43487178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MGRGRVVLER IENKINRQVT FSKRRSGLLK KAFELCVLCD AEVALIIFSS RGKLFQYSST  60
DISKIIERYR QCRYNKLQAA NSFGHESQNI YQEYLKLKGK YESLDRRQRH FHGEELEALS  120
MKELQSLEEQ LESTLAQVRQ QQTKKLLSRA EELREKVHNL EELNKKLESK RMDEFSNLVA  180
DKNSHIQLHA IQANHFE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D3e-23275172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-23275172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-23275172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A3e-23275172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J3e-23275172Myocyte-specific enhancer factor 2A
3p57_I3e-23275172Myocyte-specific enhancer factor 2A
3p57_D3e-23275172Myocyte-specific enhancer factor 2A
3p57_C3e-23275172Myocyte-specific enhancer factor 2A
3p57_B3e-23275172Myocyte-specific enhancer factor 2A
3p57_A3e-23275172Myocyte-specific enhancer factor 2A
3kov_J3e-23275172Myocyte-specific enhancer factor 2A
3kov_I3e-23275172Myocyte-specific enhancer factor 2A
3kov_B3e-23275172Myocyte-specific enhancer factor 2A
3kov_A3e-23275172Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1372898e-92BT137289.1 Medicago truncatula clone JCVI-FLMt-16G17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004513659.11e-141PREDICTED: truncated transcription factor CAULIFLOWER D-like isoform X1
SwissprotQ6EU391e-64MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBLK7LE111e-103K7LE11_SOYBN; Uncharacterized protein
STRINGGLYMA16G32540.11e-102(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132231730
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.12e-52MIKC_MADS family protein